[KO Validated] MEK2 Rabbit polyclonal antibody

Größe

Auf Anfrage

SKU:: A14770
Zusätzliche Namen:: CFC4|K2|MAPKK2|MEK2|MKK2|PRKMK2
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 45kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MLARRKPVLPALTINPTIAEGPSPTSEGASEANLVDLQKKLEELELDEQQKKRLEAFLTQKAKVGELKDDDFERISELGAGNGGVVTKVQHRPSGLIMAR
Uniprot:: P36507
Synonyme:: CFC4;dual specificity mitogen-activated protein kinase kinase 2;ERK activator kinase 2;MAP kinase kinase 2;MAPK/ERK kinase 2;MAPKK2;MEK2;mitogen-activated protein kinase kinase 2, p45;MKK2;PRKMK2
Weitere Details:: The protein encoded by this gene is a dual specificity protein kinase that belongs to the MAP kinase kinase family. This kinase is known to play a critical role in mitogen growth factor signal transduction. It phosphorylates and thus activates MAPK1/ERK2 and MAPK2/ERK3. The activation of this kinase itself is dependent on the Ser/Thr phosphorylation by MAP kinase kinase kinases. Mutations in this gene cause cardiofaciocutaneous syndrome (CFC syndrome), a disease characterized by heart defects, cognitive disability, and distinctive facial features similar to those found in Noonan syndrome. The inhibition or degradation of this kinase is also found to be involved in the pathogenesis of Yersinia and anthrax. A pseudogene, which is located on chromosome 7, has been identified for this gene.

Versandbedingungen:: Blue Ice