NDUFA5 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A14751
Zusätzliche Namen:: B13|CI-13kB|CI-13KD-B|NDUFA5|NUFM|UQOR13
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 13kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MAGVLKKTTGLVGLAVCNTPHERLRILYTKILDVLEEIPKNAAYRKYTEQITNEKLAMVKAEPDVKKLEDQLQGGQLEEVILQAEHELNLARKMREWKLWEPLVEEPPADQWKWPI
Uniprot:: Q16718
Synonyme:: B13;CI-13kB;CI-13KD-B;complex I 13kDa subunit B;complex I subunit B13;Complex I-13kD-B;NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 5, 13kDa;NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5;NADH-ubiquinone oxidoreductase 13 kDa-B subunit;NUFM;type I dehydrogenase;ubiquinone reductase;UQOR13
Weitere Details:: This nuclear gene encodes a conserved protein that comprises the B13 subunit of complex I of the mitochondrial respiratory chain. The encoded protein localizes to the inner mitochondrial membrane, where it is thought to aid in the transfer of electrons from NADH to ubiquinone. Alternative splicing results in multiple transcript variants. There are numerous pseudogenes of this gene on chromosomes 1, 3, 6, 8, 9, 11, 12, and 16.