ISG20 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A14744
Zusätzliche Namen:: CD25|HEM45|ISG20
Anwendung:: ELISA, WB
Molekulargewicht:: 20kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MAGSREVVAMDCEMVGLGPHRESGLARCSLVNVHGAVLYDKFIRPEGEITDYRTRVSGVTPQHMVGATPF
Uniprot:: Q96AZ6
Synonyme:: CD25;estrogen-regulated transcript 45 protein;HEM45;interferon stimulated exonuclease gene 20kDa;interferon-stimulated gene 20 kDa protein;promyelocytic leukemia nuclear body-associated protein ISG20
Weitere Details:: Enables 3'-5' exonuclease activity and RNA binding activity. Involved in defense response to virus; negative regulation of viral genome replication; and nucleobase-containing compound catabolic process. Located in cytoplasm and nuclear lumen.