HCRTR1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A14740
Zusätzliche Namen:: HCRTR1|ORXR1|OX1R|OXR1
Anwendung:: ELISA, WB, IF
Molekulargewicht:: 48kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: HPLLFKSTARRARGSILGIWAVSLAIMVPQAAVMECSSVLPELANRTRLFSVCDERWADDLYPKIYHSCFFIVTYLAPLGLMAMAYFQIFRKLWGRQIPGT
Uniprot:: O43613
Synonyme:: hypocretin (orexin) receptor 1;hypocretin receptor type 1;orexin receptor 1;orexin receptor type 1;ORXR1;OX1R;OXR1
Weitere Details:: The protein encoded by this gene is a G-protein coupled receptor involved in the regulation of feeding behavior. The encoded protein selectively binds the hypothalamic neuropeptide orexin A. A related gene (HCRTR2) encodes a G-protein coupled receptor that binds orexin A and orexin B.