GNAZ Rabbit polyclonal antibody

Größe

£152.00

SKU:: A14737
Zusätzliche Namen:: GNAZ|gz-alpha|HG1H
Anwendung:: ELISA, WB
Molekulargewicht:: 41kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: LFDSICNNNWFINTSLILFLNKKDLLAEKIRRIPLTICFPEYKGQNTYEEAAVYIQRQFEDLNRNKETKEIYSHFTCATDTSNIQFVFDAVTDVIIQNNLK
Uniprot:: P19086
Synonyme:: g(x) alpha chain;guanine nucleotide binding protein (G protein), alpha z polypeptide;guanine nucleotide-binding protein G(z) subunit alpha;gz-alpha;transducin alpha
Weitere Details:: The protein encoded by this gene is a member of a G protein subfamily that mediates signal transduction in pertussis toxin-insensitive systms. This encoded protein may play a role in maintaining the ionic balance of perilymphatic and endolymphatic cochlear fluids.