A14728
EPHB6 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A14728
- Zusätzliche Namen:
- EPHB6|HEP
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 111kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- HFDQLVAAFDKMIRKPDTLQAGGDPGERPSQALLTPVALDFPCLDSPQAWLSAIGLECYQDNFSKFGLCTFSDVAQLSLEDLPALGITLAGHQKKLLHHIQLLQQHLRQQGSVEV
- Uniprot:
- O15197
- Synonyme:
- ephrin type-B receptor 6;HEP;human kinase-defective Eph-family receptor protein;tyrosine-protein kinase-defective receptor EPH-6
- Weitere Details:
- This gene encodes a member of a family of transmembrane proteins that function as receptors for ephrin-B family proteins. Unlike other members of this family, the encoded protein does not contain a functional kinase domain. Activity of this protein can influence cell adhesion and migration. Expression of this gene is downregulated during tumor progression, suggesting that the protein may suppress tumor invasion and metastasis. Alternative splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice