DHX8 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A14724
Zusätzliche Namen:: DDX8|Dhr2|DHX8|HRH1|PRP22|PRPF22
Anwendung:: ELISA, WB
Molekulargewicht:: 139kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: CSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQTEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKSTVRVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPEWVVYHELVLTTKEYMREVTTIDPRWLVEFAPAFFKVSDPTKLSKQKKQQRLEPLYNRYEEPNAWRISRAFRRR
Uniprot:: Q14562
Synonyme:: ATP-dependent RNA helicase DHX8;DDX8;DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 8 (RNA helicase);DEAH (Asp-Glu-Ala-His) box polypeptide 8;DEAH box protein 8;Dhr2;HRH1;PRP22;PRPF22;RNA helicase HRH1
Weitere Details:: This gene is a member of the DEAH box polypeptide family. The encoded protein contains the DEAH (Asp-Glu-Ala-His) motif which is characteristic of all DEAH box proteins, and is thought to function as an ATP-dependent RNA helicase that regulates the release of spliced mRNAs from spliceosomes prior to their export from the nucleus. This protein may be required for the replication of human immunodeficiency virus type 1 (HIV-1). Alternative splicing results in multiple transcript variants.