DAD1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A14723
Zusätzliche Namen:: DAD1|OST2
Anwendung:: ELISA, WB
Molekulargewicht:: 22kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MSASVVSVISRFLEEYLSSTPQRLKLLDAYLLYILLTGALQFGYCLLVGTFPFNSFLSGFISCVGSFILAVCLRIQINPQNKADFQGISPERAFADFLFA
Uniprot:: P61803
Synonyme:: DAD-1;Defender against cell death 1;dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1;oligosaccharyl transferase subunit DAD1;oligosaccharyltransferase 2 homolog;oligosaccharyltransferase subunit 2 (non-catalytic);OST2
Weitere Details:: DAD1, the defender against apoptotic cell death, was initially identified as a negative regulator of programmed cell death in the temperature sensitive tsBN7 cell line. The DAD1 protein disappeared in temperature-sensitive cells following a shift to the nonpermissive temperature, suggesting that loss of the DAD1 protein triggered apoptosis. DAD1 is believed to be a tightly associated subunit of oligosaccharyltransferase both in the intact membrane and in the purified enzyme, thus reflecting the essential nature of N-linked glycosylation in eukaryotes.