COX7A1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A14721
Zusätzliche Namen:: COX7A|COX7A1|COX7AH|COX7AM
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 9kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MQALRVSQALIRSFSSTARNRFQNRVREKQKLFQEDNDIPLYLKGGIVDNILYRVTMTLCLGGTVYSLYSLGWASFPRN
Uniprot:: P24310
Synonyme:: COX7A;COX7AH;COX7AM;cytochrome c oxidase subunit 7A1, mitochondrial;cytochrome c oxidase subunit VIIa polypeptide 1 (muscle);cytochrome c oxidase subunit VIIa-H;cytochrome c oxidase subunit VIIa-heart;cytochrome c oxidase subunit VIIa-M;cytochrome c oxidase subunit VIIa-muscle
Weitere Details:: Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes polypeptide 1 (muscle isoform) of subunit VIIa and the polypeptide 1 is present only in muscle tissues. Other polypeptides of subunit VIIa are present in both muscle and nonmuscle tissues, and are encoded by different genes.

Versandbedingungen:: Blue Ice