CACNB3 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A14710
Zusätzliche Namen:: CAB3|CACNB3|CACNLB3
Anwendung:: ELISA, WB
Molekulargewicht:: 58kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: VYWRATHHPAPGPGLLGPPSAIPGLQNQQLLGERGEEHSPLERDSLMPSDEASESSRQAWTGSSQRSSRHLEEDYADAYQDLYQPHRQHTSGLPSANGHDPQDRLLAQDSEHNHSDRNWQRNRPWPKDSY
Uniprot:: P54284
Synonyme:: CAB3;CACNLB3;Calcium channel voltage-dependent subunit beta 3;calcium channel, voltage-dependent, beta 3 subunit;voltage-dependent L-type calcium channel subunit beta-3
Weitere Details:: This gene encodes a regulatory beta subunit of the voltage-dependent calcium channel. Beta subunits are composed of five domains, which contribute to the regulation of surface expression and gating of calcium channels and may also play a role in the regulation of transcription factors and calcium transport.