A14706
ATP6V1A Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A14706
- Zusätzliche Namen:
- ARCL2D|ATP6A1|ATP6V1A|ATP6V1A1|DEE93|HO68|IECEE3|VA68|Vma1|VPP2
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 68kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- SLAETDKITLEVAKLIKDDFLQQNGYTPYDRFCPFYKTVGMLSNMIAFYDMARRAVETTAQSDNKITWSIIREHMGDILYKLSSMKFKDPLKDGEAKIKSD
- Uniprot:
- P38606
- Synonyme:
- ARCL2D;ATP6A1;ATP6V1A1;ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A;ATPase, H+ transporting, lysosomal, subunit A1;DEE93;H(+)-transporting two-sector ATPase, subunit A;H+-transporting ATPase chain A, vacuolar (VA68 type);HO68;IECEE3;V-ATPase 69 kDa subunit;V-ATPase 69 kDa subunit 1;V-ATPase A subunit 1;V-ATPase subunit A;V-type proton ATPase (V-ATPase) catalytic subunit A;V-type proton ATPase catalytic subunit A;VA68;Vacuolar ATPase isoform VA68;vacuolar proton pump alpha subunit 1;vacuolar proton pump subunit alpha;Vma1;VPP2
- Weitere Details:
- This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c", and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This encoded protein is one of two V1 domain A subunit isoforms and is found in all tissues. Transcript variants derived from alternative polyadenylation exist.
- Versandbedingungen:
- Blue Ice

