KDM7A Rabbit polyclonal antibody

Größe

£152.00

SKU:: A14692
Zusätzliche Namen:: A630082K20Rik|Jhdm1d|KDM7A|mKIAA1718
Anwendung:: ELISA, WB
Molekulargewicht:: 106kDa
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: WHRHDYTEVDDGSKPVQAGTRAFVKELRSRVFPSADEIIVKMHGSQLTQRYLEKHGFDVPIMVPKLDDLGLRLPSPAFSVMDVERYVGGDKVIDVIDVARQ
Uniprot:: Q3UWM4
Synonyme:: A630082K20Rik;BB041802;histone lysine demethylase JHDM1D;JHDM1D;jmjC domain-containing histone demethylation protein 1D;jumonji C domain containing histone demethylase 1 homolog D;jumonji C domain-containing histone demethylase 1 homolog D;Kdm7;lysine (K)-specific demethylase 7A;lysine-specific demethylase 7;lysine-specific demethylase 7A;mKIAA1718
Weitere Details:: Enables histone H3-methyl-lysine-9 demethylase activity and histone H3-tri/di-methyl-lysine-27 demethylase activity. Involved in histone H3-K27 demethylation; histone H3-K9 demethylation; and positive regulation of transcription, DNA-templated. Predicted to be located in nucleolus and nucleoplasm. Human ortholog(s) of this gene implicated in melanoma. Orthologous to human KDM7A (lysine demethylase 7A).