GLI1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A14675
Zusätzliche Namen:: GLI|GLI1|PAPA8|PPD1
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 150 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: LSSLDEGPCIAGTGLSTLRRLENLRLDQLHQLRPIGTRGLKLPSLSHTGTTVSRRVGPPVSLERRSSSSSSISSAYTVSRRSSLASPFPPGSPPENGASSL
Uniprot:: P08151
Synonyme:: GLI;GLI-Kruppel family member GLI1;Glioma-associated oncogene;glioma-associated oncogene 1;glioma-associated oncogene homolog 1 (zinc finger protein);oncogene GLI;PAPA8;PPD1;zinc finger protein GLI1
Weitere Details:: This gene encodes a member of the Kruppel family of zinc finger proteins. The encoded transcription factor is activated by the sonic hedgehog signal transduction cascade and regulates stem cell proliferation. The activity and nuclear localization of this protein is negatively regulated by p53 in an inhibitory loop. Multiple transcript variants encoding different isoforms have been found for this gene.