A14630
DCSTAMP Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A14630
- Zusätzliche Namen:
- DCSTAMP|FIND|hDC-STAMP|TM7SF4
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 53kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- KILVSASFYPSVERKRIQYLHAKLLKKRSKQPLGEVKRRLSLYLTKIHFWLPVLKMIRKKQMDMASADKS
- Uniprot:
- Q9H295
- Synonyme:
- DC-specific transmembrane protein;dendritic cell-specific transmembrane protein;Dendritic cells (DC)-specific transmembrane protein;Dendrocyte-expressed seven transmembrane protein;FIND;hDC-STAMP;IL-4-induced protein;IL-Four (IL-4) induced;IL-Four INDuced;IL-four-induced protein;TM7SF4;transmembrane 7 superfamily member 4
- Weitere Details:
- This gene encodes a seven-pass transmembrane protein that is primarily expressed in dendritic cells. The encoded protein is involved in a range of immunological functions carried out by dendritic cells. This protein plays a role in osteoclastogenesis and myeloid differentiation. Alternate splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice

