A14629
MEAF6 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A14629
- Zusätzliche Namen:
- C1orf149|CENP-28|EAF6|MEAF6|NY-SAR-91
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 28kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MAMHNKAAPPQIPDTRRELAELVKRKQELAETLANLERQIYAFEGSYLEDTQMYGNIIRGWDRYLTNQKNSNSKNDRRNRKFKEAERLFSKSSVTSAAAVSALAGVQDQLIEKREPGSGTESDTSPDFHNQENEPSQEDPEDLDGSVQGVKPQKAASSTSSGSHHSSHKKRKNKNRHRIDLKLNKKPRADY
- Uniprot:
- Q9HAF1
- Synonyme:
- C1orf149;CENP-28;centromere protein 28;chromatin modification-related protein MEAF6;EAF6;Esa1-associated factor 6 homolog;Esa1p-associated factor 6 homolog;NY-SAR-91;protein EAF6 homolog;sarcoma antigen NY-SAR-91
- Weitere Details:
- This gene encodes a nuclear protein involved in transcriptional activation. The encoded protein may form a component of several different histone acetyltransferase complexes. There is a pseudogene for this gene on chromosome 2. Alternative splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice