A14615
CCT6B Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A14615
- Zusätzliche Namen:
- CCT-zeta-2|CCT6B|CCTZ-2|Cctz2|TCP-1-zeta-2|TSA303
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 58kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- AEGFEAAKIKALEVLEEVKVTKEMKRKILLDVARTSLQTKVHAELADVLTEVVVDSVLAVRRPGYPIDLFMVEIMEMKHKLGTDTKLIQGLVLDHGARHPDMKKRVEDAFILICNVSLEYEKTEVNSGFFYKTAEEKEKLVKAERKFIEDRVQKIIDLKDKVCAQSNKGFVVINQKGIDPFSLDSLAKHGIVALRRAKRRNMERLSLACGGMAVNSFEDLT
- Uniprot:
- Q92526
- Synonyme:
- CCT-zeta-2;CCT-zeta-like;CCTZ-2;Cctz2;chaperonin containing TCP1, subunit 6B (zeta 2);chaperonin-containing T-complex polypeptide 1, subunit 6B;T-complex protein 1 subunit zeta-2;TCP-1-zeta-2;TCP-1-zeta-like;testis-specific protein TSA303;testis-specific Tcp20;TSA303
- Weitere Details:
- This gene encodes a molecular chaperone that is a member of the chaperonin-containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternative splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice





