CCT6B Rabbit polyclonal antibody

Größe

£152.00

SKU:: A14615
Zusätzliche Namen:: CCT-zeta-2|CCT6B|CCTZ-2|Cctz2|TCP-1-zeta-2|TSA303
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 58kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: AEGFEAAKIKALEVLEEVKVTKEMKRKILLDVARTSLQTKVHAELADVLTEVVVDSVLAVRRPGYPIDLFMVEIMEMKHKLGTDTKLIQGLVLDHGARHPDMKKRVEDAFILICNVSLEYEKTEVNSGFFYKTAEEKEKLVKAERKFIEDRVQKIIDLKDKVCAQSNKGFVVINQKGIDPFSLDSLAKHGIVALRRAKRRNMERLSLACGGMAVNSFEDLT
Uniprot:: Q92526
Synonyme:: CCT-zeta-2;CCT-zeta-like;CCTZ-2;Cctz2;chaperonin containing TCP1, subunit 6B (zeta 2);chaperonin-containing T-complex polypeptide 1, subunit 6B;T-complex protein 1 subunit zeta-2;TCP-1-zeta-2;TCP-1-zeta-like;testis-specific protein TSA303;testis-specific Tcp20;TSA303
Weitere Details:: This gene encodes a molecular chaperone that is a member of the chaperonin-containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternative splicing results in multiple transcript variants.

Versandbedingungen:: Blue Ice