SRSF6 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A14603
Zusätzliche Namen:: B52|HEL-S-91|SFRS6|SRP55|SRSF6
Anwendung:: ELISA, WB
Molekulargewicht:: 55kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MPRVYIGRLSYNVREKDIQRFFSGYGRLLEVDLKNGYGFVEFEDSRDADDAVYELNGKELCGERVIVEHARGPRRDRDGYSYGSRSGGGGYSSRRTSGRD
Uniprot:: Q13247
Synonyme:: B52;epididymis secretory protein Li 91;HEL-S-91;pre-mRNA-splicing factor SRP55;serine/arginine-rich splicing factor 6;SFRS6;Splicing factor, arginine/serine-rich 6;splicing factor, arginine/serine-rich, 55 kDa;SR splicing factor 6;SRP55
Weitere Details:: The protein encoded by this gene is involved in mRNA splicing and may play a role in the determination of alternative splicing. The encoded nuclear protein belongs to the splicing factor SR family and has been shown to bind with and modulate another member of the family, SFRS12. Alternative splicing results in multiple transcript variants. In addition, two pseudogenes, one on chromosome 17 and the other on the X chromosome, have been found for this gene.