A14577
CAP1 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A14577
- Zusätzliche Namen:
- CAP|CAP1|CAP1-PEN
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 60 kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MADMQNLVERLERAVGRLEAVSHTSDMHRGYADSPSKAGAAPYVQAFDSLLAGPVAEYLKISKEIGGDVQKHAEMVHTGLKLERALLVTASQCQQPAENK
- Uniprot:
- Q01518
- Synonyme:
- adenylate cyclase associated protein 1;adenylyl cyclase-associated protein 1;CAP;CAP, adenylate cyclase-associated protein 1;CAP1-PEN;testis secretory sperm-binding protein Li 218p
- Weitere Details:
- The protein encoded by this gene is related to the S. cerevisiae CAP protein, which is involved in the cyclic AMP pathway. The human protein is able to interact with other molecules of the same protein, as well as with CAP2 and actin. Alternatively spliced transcript variants encoding different isoforms have been identified.
- Versandbedingungen:
- Blue Ice

