SLC47A1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A14559
Zusätzliche Namen:: MATE1|SLC47A1
Anwendung:: ELISA, WB
Molekulargewicht:: 62kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: LNWKKACQQAQVHANLKVNNVPRSGNSALPQDPLHPGCPENLEGILTNDVGKTGEPQSDQQMRQEEPLPEHPQDGAKLSRKQLVLRRGLLL
Uniprot:: Q96FL8
Synonyme:: hMATE-1;MATE-1;MATE1;multidrug and toxin extrusion 1;multidrug and toxin extrusion protein 1;solute carrier family 47 (multidrug and toxin extrusion), member 1;Solute carrier family 47 member 1
Weitere Details:: This gene is located within the Smith-Magenis syndrome region on chromosome 17. It encodes a protein of unknown function.