TOMM22 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A14548
Zusätzliche Namen:: 1C9-2|MST065|MSTP065|TOM22|TOMM22
Anwendung:: ELISA, WB
Molekulargewicht:: 16kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MAAAVAAAGAGEPQSPDELLPKGDAEKPEEELEEDDDEELDETLSERLWGLTEMFPERVRSAAGATFDLSLFVAQKMYRFSRA
Uniprot:: Q9NS69
Synonyme:: 1C9-2;mitochondrial import receptor subunit TOM22 homolog;mitochondrial import receptor Tom22;MST065;MSTP065;TOM22;translocase of outer membrane 22 kDa subunit homolog;translocase of outer mitochondrial membrane 22 homolog
Weitere Details:: The protein encoded by this gene is an integral membrane protein of the mitochondrial outer membrane. The encoded protein interacts with TOMM20 and TOMM40, and forms a complex with several other proteins to import cytosolic preproteins into the mitochondrion.