A14546
NGDN Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A14546
- Zusätzliche Namen:
- C14orf120|CANu1|LCP5|lpd-2|NGD|NGDN
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 36kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- LMYLMDLTHLILDKASGGSLQGHDAVLRLVEIRTVLEKLRPLDQKLKYQIDKLIKTAVTGSLSENDPLRFKPHPSNMMSKLSSEDEEEDEAEDDQSEASGKKSVKGVSKKYVPPRLVPVHYDETEAEREKKRLERAKRRALSSSVIREL
- Uniprot:
- Q8NEJ9
- Synonyme:
- C14orf120;CANu1;centromere accumulated nuclear protein 1;EIF4E-binding protein;eukaryotic initiation factor 4E and CPEB binding protein;LCP5;lpd-2;neuroguidin;neuroguidin, EIF4E binding protein;NGD
- Weitere Details:
- Neuroguidin is an EIF4E (MIM 133440)-binding protein that interacts with CPEB (MIM 607342) and functions as a translational regulatory protein during development of the vertebrate nervous system (Jung et al., 2006 [PubMed 16705177]).
- Versandbedingungen:
- Blue Ice

