[KO Validated] Glutathione Synthetase (GSS) Rabbit polyclonal antibody

Größe

Auf Anfrage

SKU:: A14535
Zusätzliche Namen:: GSHS|HEL-S-64p|HEL-S-88n|S)
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 52kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: NLYGEEMVQALKQLKDSEERASYILMEKIEPEPFENCLLRPGSPARVVQCISELGIFGVYVRQEKTLVMNKHVGHLLRTKAIEHADGGVAAGVAVLDNPYPV
Uniprot:: P48637
Synonyme:: glutathione synthase;glutathione synthetase;GSH synthetase;GSH-S;GSHS;HEL-S-64p;HEL-S-88n
Weitere Details:: Glutathione is important for a variety of biological functions, including protection of cells from oxidative damage by free radicals, detoxification of xenobiotics, and membrane transport. The protein encoded by this gene functions as a homodimer to catalyze the second step of glutathione biosynthesis, which is the ATP-dependent conversion of gamma-L-glutamyl-L-cysteine to glutathione. Defects in this gene are a cause of glutathione synthetase deficiency.