A14527
CISH Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A14527
- Zusätzliche Namen:
- BACTS2|CIS|CIS-1|CISH|G18|SOCS
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 37kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- TGQRPLWAPSLELPKPVMQPLPAGAFLEEVAEGTPAQTESEPKVLDPEEDLLCIAKTFSYLRESGWYWGSITASEARQHLQKMPEGTFLVRDSTHPSYLFTLSVKTTRGPTNVR
- Uniprot:
- Q9NSE2
- Synonyme:
- BACTS2;CIS;CIS-1;cytokine-inducible inhibitor of signaling type 1B;cytokine-inducible SH2-containing protein;G18;Protein G18;SOCS;suppressor of cytokine signaling
- Weitere Details:
- The protein encoded by this gene contains a SH2 domain and a SOCS box domain. The protein thus belongs to the cytokine-induced STAT inhibitor (CIS), also known as suppressor of cytokine signaling (SOCS) or STAT-induced STAT inhibitor (SSI), protein family. CIS family members are known to be cytokine-inducible negative regulators of cytokine signaling. The expression of this gene can be induced by IL2, IL3, GM-CSF and EPO in hematopoietic cells. Proteasome-mediated degradation of this protein has been shown to be involved in the inactivation of the erythropoietin receptor. Multiple transcript variants encoding different isoforms have been found for this gene.
- Versandbedingungen:
- Blue Ice



