NLRP12 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A14519
Zusätzliche Namen:: CLR19.3|FCAS2|NALP12|NLRP12|PAN6|PYPAF7|RNO|RNO2
Anwendung:: ELISA, WB
Molekulargewicht:: 120kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: WLKICRLTAAACDELASTLSVNQSLRELDLSLNELGDLGVLLLCEGLRHPTCKLQTLRLGICRLGSAACEGLSVVLQANHNLRELDLSFNDLGDWGLWLLAEGLQHPACRLQKLWLDSCGLTAKACENLYFTLGINQTLTDLYLTNNALGDTGVRLLCKRLSHPGCKLRVLWLFGMDLNKMTHSRLAALRVTKPYLDIGC
Uniprot:: P59046
Synonyme:: CLR19.3;FCAS2;monarch 1;Monarch-1;NACHT, LRR and PYD domains-containing protein 12;NALP12;nucleotide-binding oligomerization domain, leucine rich repeat and pyrin domain containing 12;PAN6;PYPAF7;PYRIN-containing APAF1-like protein 7;regulated by nitric oxide;RNO;RNO2
Weitere Details:: This gene encodes a member of the CATERPILLER family of cytoplasmic proteins. The encoded protein, which contains an N-terminal pyrin domain, a NACHT domain, a NACHT-associated domain, and a C-terminus leucine-rich repeat region, functions as an attenuating factor of inflammation by suppressing inflammatory responses in activated monocytes. Mutations in this gene cause familial cold autoinflammatory syndrome type 2. Alternative splicing results in multiple transcript variants.

Versandbedingungen:: Blue Ice