NGDN Rabbit polyclonal antibody

Größe

£152.00

SKU:: A14509
Zusätzliche Namen:: C14orf120|CANu1|LCP5|lpd-2|NGD|NGDN
Anwendung:: ELISA, WB
Molekulargewicht:: Refer to Figures
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: LMYLMDLTHLILDKASGGSLQGHDAVLRLVEIRTVLEKLRPLDQKLKYQIDKLIKTAVTGSLSENDPLRFKPHPSNMMSKLSSEDEEEDEAEDDQSEASGKKSVKGVSKKYVPPRLVPVHYDETEAEREKKRLERAKRRALSSSVIREL
Uniprot:: Q8NEJ9
Synonyme:: C14orf120;CANu1;centromere accumulated nuclear protein 1;EIF4E-binding protein;eukaryotic initiation factor 4E and CPEB binding protein;LCP5;lpd-2;neuroguidin;neuroguidin, EIF4E binding protein;NGD
Weitere Details:: Neuroguidin is an EIF4E (MIM 133440)-binding protein that interacts with CPEB (MIM 607342) and functions as a translational regulatory protein during development of the vertebrate nervous system (Jung et al., 2006 [PubMed 16705177]).