PRAME Rabbit polyclonal antibody

Größe

£152.00

SKU:: A14507
Zusätzliche Namen:: CT130|MAPE|OIP-4|OIP4|PRAME
Anwendung:: ELISA, WB
Molekulargewicht:: 58kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MERRRLWGSIQSRYISMSVWTSPRRLVELAGQSLLKDEALAIAALELLPRELFPPLFMAAFDGRHSQTLKAMVQAWPFTCLPLGVLMKGQHLHLETFKAVLDGLDVLLAQEVRPRRWKLQVLDLRKNSHQDFWTVWSGNRASLYSFPEPEAAQPMTKKRKVDGLSTEAEQPFIPVEVLVDLFLKEGACDELFSYLIEKVK
Uniprot:: P78395
Synonyme:: cancer/testis antigen 130;CT130;MAPE;melanoma antigen preferentially expressed in tumors;OIP-4;OIP4;opa-interacting protein 4;Opa-interacting protein OIP4;preferentially expressed antigen in melanoma;preferentially expressed antigen of melanoma
Weitere Details:: This gene encodes an antigen that is preferentially expressed in human melanomas and that is recognized by cytolytic T lymphocytes. It is not expressed in normal tissues, except testis. The encoded protein acts as a repressor of retinoic acid receptor, and likely confers a growth advantage to cancer cells via this function. Alternative splicing results in multiple transcript variants.