NCR1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A14499
Zusätzliche Namen:: CD335|LY94|NCR1|NK-p46|NKP46
Anwendung:: ELISA, WB
Molekulargewicht:: 34kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: SMFLLLKEGRSSHVQRGYGKVQAEFPLGPVTTAHRGTYRCFGSYNNHAWSFPSEPVKLLVTGDIENTSLAPEDPTFPDTWGTYLLTTETGLQKDHALWDHTAQNLLRMGLAFLVLVALVWFLVEDWLSRKRTRERASRASTWEGRRRLNTQTL
Uniprot:: O76036
Synonyme:: CD335;LY94;Lymphocyte antigen 94 homolog;lymphocyte antigen 94 homolog (activating NK-receptor; NK-p46);natural cytotoxicity triggering receptor 1;natural killer cell p46-related protein;NK cell-activating receptor;NK-p46;NKP46
Weitere Details:: Predicted to be involved in cellular defense response; regulation of natural killer cell mediated cytotoxicity; and signal transduction. Predicted to act upstream of or within defense response to virus and detection of virus. Predicted to be located in cell surface. Predicted to be part of SWI/SNF complex. Predicted to be active in plasma membrane. Biomarker of acquired immunodeficiency syndrome; anogenital venereal wart; hepatitis C; and lymphoproliferative syndrome.