A14455
ALDH1L2 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A14455
- Zusätzliche Namen:
- ALDH1L2|mtFDH
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 102kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- EPLEIKGAKKPGLVTKNGLVLFGNDGKALTVRNLQFEDGKMIPASQYFSTGETSVVELTAEEVKVAETIKVIWAGILSNVPIIEDSTDFFKSGASSMDVARLVEEIRQKCGGLQLQNEDVYMATKFEGFIQKVVRKLRGEDQEVELVVDYISKEVNEIMVKMPYQCFINGQFTDADDGKTYDTINPTDGSTICKVSYASLA
- Uniprot:
- Q3SY69
- Synonyme:
- 10-formyltetrahydrofolate dehydrogenase ALDH1L2;Aldehyde dehydrogenase family 1 member L2;aldehyde dehydrogenase family 1 member L2, mitochondrial;mitochondrial 10-formyltetrahydrofolate dehydrogenase;mitochondrial 10-FTHFDH;mtFDH;probable 10-formyltetrahydrofolate dehydrogenase ALDH1L2
- Weitere Details:
- This gene encodes a member of both the aldehyde dehydrogenase superfamily and the formyl transferase superfamily. This member is the mitochondrial form of 10-formyltetrahydrofolate dehydrogenase (FDH), which converts 10-formyltetrahydrofolate to tetrahydrofolate and CO2 in an NADP(+)-dependent reaction, and plays an essential role in the distribution of one-carbon groups between the cytosolic and mitochondrial compartments of the cell. Alternatively spliced transcript variants have been found for this gene.
- Versandbedingungen:
- Blue Ice