ATP6V1G3 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A14443
Zusätzliche Namen:: ATP6G3|ATP6V1G3|Vma10
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 14kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MTSQSQGIHQLLQAEKRAKDKLEEAKKRKGKRLKQAKEEAMVEIDQYRMQRDKEFRLKQSKIMGSQNNLSDEIEEQTLGKIQELNGHYNKYMESVMNQLLSMVCDMKPEIHVNYRATN
Uniprot:: Q96LB4
Synonyme:: ATP6G3;ATPase, H+ transporting, lysosomal (vacuolar proton pump) subunit G3;ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G3;V-ATPase 13 kDa subunit 3;V-ATPase G subunit 3;V-ATPase G3 subunit;V-ATPase subunit G 3;V-type proton ATPase subunit G 3;vacuolar ATP synthase subunit G 3;vacuolar proton pump G subunit 3;vacuolar proton pump subunit G 3;vacuolar proton pump, subunit G3;Vma10
Weitere Details:: This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c'' and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This gene encodes one of three G subunit proteins. Transcript variants encoding different isoforms have been found for this gene.

Versandbedingungen:: Blue Ice