PSD2 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A14429
Zusätzliche Namen:: EFA6C|PSD2
Anwendung:: ELISA, WB
Molekulargewicht:: 85kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MEEDKLLSAVPEEGDATRDPGPEPEEEPGVRNGMASEGLNSSLCSPGHERRGTPADTEEPTKDPDVAFHGLSLGLSLTNGLALGPDLNILEDSAESRPWRAGVLAEGDNASRSLYPDAEDPQLGLDGPGEPDVRDGFSATFEKILESELLRGTQYSSLDSLDGLSLTDESDSCVSFEAPLTPLIQQRARD
Uniprot:: Q9BQI7
Synonyme:: EFA6C;exchange factor for ADP-ribosylation factor guanine nucleotide factor 6 C;exchange factor for ARF6 C;PH and SEC7 domain-containing protein 2;pleckstrin homology and SEC7 domain-containing protein 2
Weitere Details:: Predicted to enable guanyl-nucleotide exchange factor activity and phospholipid binding activity. Predicted to be involved in regulation of ARF protein signal transduction and regulation of catalytic activity. Predicted to be located in cleavage furrow and ruffle membrane. Predicted to be active in glutamatergic synapse and postsynapse.