NOL6 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A14420
Zusätzliche Namen:: bA311H10.1|NOL6|NRAP|UTP22
Anwendung:: ELISA, WB
Molekulargewicht:: 127kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: SFCRGLLSQPGPSSLMPVLGYDPPQLYLTQLREAFGDLALFFYDQHGGEVIGVLWKPTSFQPQPFKASSTKGRMVMSRGGELVMVPNVEAILEDFAVLGEGLVQTVEARSERWTV
Uniprot:: Q9H6R4
Synonyme:: bA311H10.1;NRAP;nucleolar protein 6;nucleolar protein 6 (RNA-associated);nucleolar protein family 6 (RNA-associated);nucleolar RNA-associated protein;UTP22
Weitere Details:: The nucleolus is a dense subnuclear membraneless organelle that assembles around clusters of rRNA genes and functions in ribosome biogenesis. This gene encodes a nucleolar RNA-associated protein that is highly conserved between species. RNase treatment of permeabilized cells indicates that the nucleolar localization is RNA dependent. Further studies suggest that the protein is associated with ribosome biogenesis through an interaction with pre-rRNA primary transcripts. Alternative splicing has been observed at this locus and two splice variants encoding distinct isoforms have been identified.