A14403
TXNDC12 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A14403
- Zusätzliche Namen:
- AG1|AGR1|ERP16|ERP18|ERP19|hAG-1|hTLP19|PDIA16|TLP19|TXNDC12
- Anwendung:
- ELISA, WB, IHC-P, IF, ICC
- Molekulargewicht:
- 19kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- NLEDEEEPKDEDFSPDGGYIPRILFLDPSGKVHPEIINENGNPSYKYFYVSAEQVVQGMKEAQERLTGDAFRKKHLEDEL
- Uniprot:
- O95881
- Synonyme:
- AG1;AGR1;anterior gradient homolog 1;endoplasmic reticulum protein ERp19;endoplasmic reticulum resident protein 18;endoplasmic reticulum resident protein 19;endoplasmic reticulum thioredoxin superfamily member, 18 kDa;ER protein 18;ER protein 19;ERP16;ERP18;ERP19;hAG-1;hTLP19;PDIA16;protein disulfide isomerase family A, member 16;thioredoxin domain containing 12 (endoplasmic reticulum);thioredoxin domain-containing protein 12;thioredoxin-like protein p19;TLP19
- Weitere Details:
- This gene encodes a member of the thioredoxin superfamily. Members of this family are characterized by a conserved active motif called the thioredoxin fold that catalyzes disulfide bond formation and isomerization. This protein localizes to the endoplasmic reticulum and has a single atypical active motif. The encoded protein is mainly involved in catalyzing native disulfide bond formation and displays activity similar to protein-disulfide isomerases. This protein may play a role in defense against endoplasmic reticulum stress. Alternate splicing results in both coding and non-coding variants.
- Versandbedingungen:
- Blue Ice