TSPAN15 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A14395
Zusätzliche Namen:: 2700063A19Rik|NET-7|NET7|TM4SF15|TSPAN15
Anwendung:: ELISA, WB
Molekulargewicht:: 33kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: GVVALTFRNQTIDFLNDNIRRGIENYYDDLDFKNIMDFVQKKFKCCGGEDYRDWSKNQYHDCSAPGPLACGVPYTCCIRNTTEVVNTMCGYKTIDKERFSVQDVIYVRGCT
Uniprot:: O95858
Synonyme:: 2700063A19Rik;NET-7;NET7;tetraspan NET-7;tetraspanin-15;TM4SF15;transmembrane 4 superfamily member 15;transmembrane 4 superfamily member tetraspan NET-7;tspan-15
Weitere Details:: The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. The use of alternate polyadenylation sites has been found for this gene.