A14378
NDUFB3 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A14378
- Zusätzliche Namen:
- B12|CI-B12|MC1DN25|NDUFB3
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 11kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MAHEHGHEHGHHKMELPDYRQWKIEGTPLETIQKKLAAKGLRDPWGRNEAWRYMGGFAKSVSFSDVFFKGFKWGFAAFVVAVGAEYYLESLNKDKKHH
- Uniprot:
- O43676
- Synonyme:
- B12;CI-B12;complex I-B12;MC1DN25;NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 3, 12kDa;NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3;NADH-ubiquinone oxidoreductase B12 subunit
- Weitere Details:
- This gene encodes an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) which is the first enzyme in the electron transport chain of mitochondria. This protein localizes to the inner membrane of the mitochondrion as a single-pass membrane protein. Mutations in this gene contribute to mitochondrial complex 1 deficiency. Alternative splicing results in multiple transcript variants encoding the same protein. Humans have multiple pseudogenes of this gene.
- Versandbedingungen:
- Blue Ice



