KCNJ12 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A14375
Zusätzliche Namen:: hIRK|hIRK1|hkir2.2x|IRK-2|IRK2|KCNJ12|kcnj12x|KCNJN1|Kir2.2
Anwendung:: ELISA, WB
Molekulargewicht:: 49kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: TPRCSAKDLVENKFLLPSANSFCYENELAFLSRDEEDEADGDQDGRSRDGLSPQARHDFDRLQAGGGVLEQRPYRRESEI
Uniprot:: Q14500
Synonyme:: ATP-sensitive inward rectifier potassium channel 12;hIRK;hIRK1;hkir2.2x;Inward rectifier K(+) channel Kir2.2;inward rectifier K(+) channel Kir2.2v;inward rectifier K(+) channel Kir2.6;IRK-2;IRK2;kcnj12x;KCNJN1;Kir2.2;Kir2.2v;Potassium channel, inwardly rectifying subfamily J member 12;potassium channel, inwardly rectifying subfamily J, member 12;potassium inwardly-rectifying channel, subfamily J, inhibitor 1;potassium voltage-gated channel subfamily J member 12
Weitere Details:: This gene encodes an inwardly rectifying K+ channel which may be blocked by divalent cations. This protein is thought to be one of multiple inwardly rectifying channels which contribute to the cardiac inward rectifier current (IK1). The gene is located within the Smith-Magenis syndrome region on chromosome 17.