A14372
ATP12A Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A14372
- Zusätzliche Namen:
- ATP12A|ATP1AL1|H-K-ATPase|HK
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 116kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- YFTVYAQEGFLPRTLINLRVEWEKDYVNDLKDSYGQEWTRYQREYLEWTGYTAFFVGILVQQIADLIIRKTRRNSIFQQGLFRNKVIWVGI
- Uniprot:
- P54707
- Synonyme:
- ATP1AL1;ATPase, H+/K+ transporting, nongastric, alpha polypeptide;ATPase, Na+/K+ transporting, alpha polypeptide-like 1;H-K-ATPase;HK;HK alpha 2;Non-gastric H(+)/K(+) ATPase subunit alpha;non-gastric Na(+)/K(+) ATPase subunit alpha;potassium-transporting ATPase alpha chain 2;Proton pump;sodium pump
- Weitere Details:
- The protein encoded by this gene belongs to the family of P-type cation transport ATPases. This gene encodes a catalytic subunit of the ouabain-sensitive H+/K+ -ATPase that catalyzes the hydrolysis of ATP coupled with the exchange of H(+) and K(+) ions across the plasma membrane. It is also responsible for potassium absorption in various tissues. Two transcript variants encoding different isoforms have been found for this gene.
- Versandbedingungen:
- Blue Ice