SLC25A23 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A14352
Zusätzliche Namen:: APC2|MCSC2|SCaMC-3|SCAMC3|SLC25A23
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 52kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MRGSPGDAERRQRWGRLFEELDSNKDGRVDVHELRQGLARLGGGNPDPGAQQGISSEGDADPDGGLDLEEFSRYLQEREQRLLLMFHSLDRNQDGHIDVSEIQQSFRALGISISLEQAEKILHSMDRDGTMTIDWQEWRDHFLLHSLENVEDVLYFWKHS
Uniprot:: Q9BV35
Synonyme:: APC2;calcium-binding mitochondrial carrier protein SCaMC-3;MCSC2;mitochondrial ATP-Mg/Pi carrier protein 2;mitochondrial Ca(2+)-dependent solute carrier protein 2;mitochondrial Ca2+-dependent solute carrier protein 2;SCaMC-3;SCAMC3;short calcium-binding mitochondrial carrier 3;small calcium-binding mitochondrial carrier protein 3;solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 23;Solute carrier family 25 member 23
Weitere Details:: Predicted to enable ATP transmembrane transporter activity. Involved in calcium import into the mitochondrion; positive regulation of mitochondrial calcium ion concentration; and regulation of cellular hyperosmotic salinity response. Located in mitochondrion.