RHBDD1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A14350
Zusätzliche Namen:: RHBDD1|RHBDL4|RRP4
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 35kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: TQGPLKKIMEACAGGFSSSVGYPGRQYYFNSSGSSGYQDYYPHGRPDHYEEAPRNYDTYTAGLSEEEQLERALQASLWDRGNTRNSPPPYGFHLSPEEMRRQRLHRFDSQ
Uniprot:: Q8TEB9
Synonyme:: RHBDL4;rhomboid domain-containing protein 1;rhomboid-like protein 4;rhomboid-related protein 4;RRP4
Weitere Details:: Enables serine-type endopeptidase activity. Involved in several processes, including cellular response to unfolded protein; membrane protein proteolysis; and positive regulation of protein catabolic process. Located in endoplasmic reticulum.