TRMT112 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A14310
Zusätzliche Namen:: HSPC152|HSPC170|hTrm112|TRM112|TRMT11-2|TRMT112
Anwendung:: ELISA, WB
Molekulargewicht:: 14kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MKLLTHNLLSSHVRGVGSRGFPLRLQATEVRICPVEFNPNFVARMIPKVEWSAFLEAADNLRLIQVPKGPVEGYEENEEFLRTMHHLLLEVEVIEGTLQCPESGRMFPISRGIPNMLLSEEETES
Uniprot:: Q9UI30
Synonyme:: HSPC152;HSPC170;hTrm112;multifunctional methyltransferase subunit TRM112-like protein;TRM112;TRM112-like protein;TRMT11-2;tRNA methyltransferase 11-2 homolog;tRNA methyltransferase 112 homolog;tRNA methyltransferase subunit 11-2
Weitere Details:: Enables protein heterodimerization activity and protein methyltransferase activity. Involved in macromolecule methylation and positive regulation of rRNA processing. Located in nucleoplasm and perinuclear region of cytoplasm. Part of protein-containing complex.