A14299
TNFRSF13C Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A14299
- Zusätzliche Namen:
- BAFF-R|BAFFR|BROMIX|CD268|CVID4|prolixin|TNFRSF13C
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 38kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAALPLPGLLFG
- Uniprot:
- Q96RJ3
- Synonyme:
- B cell-activating factor receptor;B-cell-activating factor receptor;BAFF receptor;BAFF-R;BAFFR;BLyS receptor 3;BROMIX;CD268;CVID4;prolixin;tumor necrosis factor receptor superfamily member 13C
- Weitere Details:
- B cell-activating factor (BAFF) enhances B-cell survival in vitro and is a regulator of the peripheral B-cell population. Overexpression of Baff in mice results in mature B-cell hyperplasia and symptoms of systemic lupus erythematosus (SLE). Also, some SLE patients have increased levels of BAFF in serum. Therefore, it has been proposed that abnormally high levels of BAFF may contribute to the pathogenesis of autoimmune diseases by enhancing the survival of autoreactive B cells. The protein encoded by this gene is a receptor for BAFF and is a type III transmembrane protein containing a single extracellular cysteine-rich domain. It is thought that this receptor is the principal receptor required for BAFF-mediated mature B-cell survival.
- Versandbedingungen:
- Blue Ice

_WB_01.jpg)