A14296
NDUFAF2 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A14296
- Zusätzliche Namen:
- B17.2L|MC1DN10|mimitin|MMTN|NDUFA12L|NDUFAF2
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 20kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MGWSQDLFRALWRSLSREVKEHVGTDQFGNKYYYIPQYKNWRGQTIREKRIVEAANKKEVDYEAGDIPTEWEAWIRRTRKTPPTMEEILKNEKHREEIKIKSQDFYEKEKLLSKETSEELLPPPVQTQIKGHASAPYFGKEEPSVAPSSTGKTFQPGSWMPRDGKSHNQ
- Uniprot:
- Q8N183
- Synonyme:
- B17.2-like;B17.2L;MC1DN10;mimitin;mimitin, mitochondrial;MMTN;Myc-induced mitochondrial protein;NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, assembly factor 2;NADH dehydrogenase (ubiquinone) complex I, assembly factor 2;NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 2;NADH dehydrogenase 1 alpha subcomplex assembly factor 2;NDUFA12-like protein;NDUFA12L
- Weitere Details:
- NADH:ubiquinone oxidoreductase (complex I) catalyzes the transfer of electrons from NADH to ubiquinone (coenzyme Q) in the first step of the mitochondrial respiratory chain, resulting in the translocation of protons across the inner mitochondrial membrane. This gene encodes a complex I assembly factor. Mutations in this gene cause progressive encephalopathy resulting from mitochondrial complex I deficiency.
- Versandbedingungen:
- Blue Ice



