A14268
CLEC4M Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A14268
- Zusätzliche Namen:
- CD209L|CD299|CLEC4M|DC-SIGN2|DC-SIGNR|DCSIGNR|HP10347|L-SIGN|LSIGN
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 45kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- QVSKVPSSLSQEQSEQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTELKAAVGELPEKSKLQEIYQELTQLKAAVGELPDQSKQQQIYQELTDLKTAFERLCRHCPKDWTFFQGNCYFMSNSQRNWHDSVTACQEVRAQLVVIKTAEEQNFLQLQTSRSNRFSWMGLSDLNQEGTWQWVDGSPLSPSFQRYWNSGEPNNSGNEDCAEFSGSGWNDNRCDVDNYWICKKPAACFRDE
- Uniprot:
- Q9H2X3
- Synonyme:
- C-type lectin domain family 4 member M;CD209 antigen-like protein 1;CD209L;CD299;CD299 antigen;DC-SIGN-related protein;DC-SIGN2;DC-SIGNR;DCSIGNR;dendritic cell-specific ICAM-3-grabbing non-integrin 2;HP10347;L-SIGN;liver/lymph node-specific ICAM-3 grabbing non-integrin;Liver/lymph node-specific ICAM-3-grabbing non-integrin;LSIGN;mannose binding C-type lectin DC-SIGNR
- Weitere Details:
- This gene encodes a C-type lectin that functions in cell adhesion and pathogen recognition. This receptor recognizes a wide range of evolutionarily divergent pathogens with a large impact on public health, including tuberculosis mycobacteria, and viruses including Ebola, hepatitis C, HIV-1, influenza A, West Nile virus and the SARS-CoV acute respiratory syndrome coronavirus. The protein is organized into four distinct domains: a C-terminal carbohydrate recognition domain, a flexible tandem-repeat neck domain of variable length, a transmembrane region and an N-terminal cytoplasmic domain involved in internalization. This gene is closely related in terms of both sequence and function to a neighboring gene, CD209 (Gene ID: 30835), also known as DC-SIGN. The two genes differ in viral recognition and expression patterns, with this gene showing high expression in endothelial cells of the liver, lymph node and placenta. Polymorphisms in the tandem repeat neck domain are associated with resistance to SARS infection.
- Versandbedingungen:
- Blue Ice





