A14242
GUCY2F Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A14242
- Zusätzliche Namen:
- CYGF|GC-F|GUC2DL|GUC2F|GUCY2F|RETGC-2|ROS-GC2
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 125kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- HSALIGGETQMHLLECAHDLKMTDGTYVFVPYDALLYSLPYKHTPYRVLRNNPKLREAYDAVLTITVESQEKTFYQAFTEAAARGEIPEKLEFDQVSPLFGTIYNSIYFIAQAMNNAMKENGQAGAASLVQHSRNMQFHGFNQLMRTDSNGNGISEYVILDTNLKEWELHSTYTVDMEMELLRFGGTPIHFPGGRPPRADAKCWFAEGKIC
- Uniprot:
- P51841
- Synonyme:
- CYGF;GC-F;guanylate cyclase 2D-like, membrane (retina-specific);Guanylate cyclase 2F, retinal;guanylate cyclase F;GUC2DL;GUC2F;RETGC-2;retinal guanylyl cyclase 2;rod outer segment membrane guanylate cyclase 2;ROS-GC2
- Weitere Details:
- The protein encoded by this gene is a guanylyl cyclase found predominantly in photoreceptors in the retina. The encoded protein is thought to be involved in resynthesis of cGMP after light activation of the visual signal transduction cascade, allowing a return to the dark state. This protein is a single-pass type I membrane protein. Defects in this gene may be a cause of X-linked retinitis pigmentosa.
- Versandbedingungen:
- Blue Ice