A14221
IFNGR2 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A14221
- Zusätzliche Namen:
- AF-1|IFGR2|IFNGR2|IFNGT1|IMD28
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 38kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- SNIFRVGHLSNISCYETMADASTELQQVILISVGTFSLLSVLAGACFFLVLKYRGLIKYWFHTPPSIPLQIEEYLKDPTQPILEALDKDSSPKDDVWDSVSI
- Uniprot:
- P38484
- Synonyme:
- AF-1;IFGR2;IFN-gamma receptor 2;IFN-gamma-R-beta;IFN-gamma-R2;IFNGT1;IMD28;interferon gamma receptor 2;Interferon gamma receptor accessory factor 1;interferon gamma receptor accessory factor-1;interferon gamma receptor beta chain;Interferon gamma receptor beta-chain;interferon gamma transducer 1
- Weitere Details:
- This gene (IFNGR2) encodes the non-ligand-binding beta chain of the gamma interferon receptor. Human interferon-gamma receptor is a heterodimer of IFNGR1 and IFNGR2. Defects in IFNGR2 are a cause of mendelian susceptibility to mycobacterial disease (MSMD), also known as familial disseminated atypical mycobacterial infection. MSMD is a genetically heterogeneous disease with autosomal recessive, autosomal dominant or X-linked inheritance.
- Versandbedingungen:
- Blue Ice

