CISD2 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A14168
Zusätzliche Namen:: CISD2|ERIS|Miner1|NAF-1|WFS2|ZCD2
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 15kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: PKKKQQKDSLINLKIQKENPKVVNEINIEDLCLTKAAYCRCWRSKTFPACDGSHNKHNELTGDNVGPLILKKKEV
Uniprot:: Q8N5K1
Synonyme:: CDGSH iron-sulfur domain-containing protein 2;endoplasmic reticulum intermembrane small protein;ERIS;Miner1;mitoNEET-related 1 protein;NAF-1;nutrient-deprivation autophagy factor-1;WFS2;ZCD2;zinc finger, CDGSH-type domain 2
Weitere Details:: The protein encoded by this gene is a zinc finger protein that localizes to the endoplasmic reticulum. The encoded protein binds an iron/sulfur cluster and may be involved in calcium homeostasis. Defects in this gene are a cause of Wolfram syndrome 2.