TGF beta Receptor II Rabbit polyclonal antibody

Größe

£152.00

SKU:: A1415
Zusätzliche Namen:: AAT3|FAA3|LDS1B|LDS2|LDS2B|MFS2|RIIC|TAAD2|tbetaR-II|TBR-ii|TBRII|TGF beta Receptor II (TGFBR2)|TGFbeta-RII|TGFR-2
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 70 kDa/85 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: TIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYNTSNPDLLLVIFQVTGISLLPPLGVAISVIIIFYCYRVNRQQKLSSTWETGKTRKLMEFSEHCAIILEDDRSDISSTCANNINHNTELLPIELDTLVGKGRFAEVYKAKLKQNTSEQFETVAVKIFP
Uniprot:: P37173
Synonyme:: AAT3;FAA3;LDS1B;LDS2;LDS2B;MFS2;RIIC;TAAD2;tbetaR-II;TBR-ii;TBRII;TGF-beta receptor type IIB;TGF-beta receptor type-2;TGF-beta type II receptor;TGFbeta-RII;TGFR-2;transforming growth factor beta receptor II;transforming growth factor beta receptor type IIC;Transforming growth factor-beta receptor type II;transforming growth factor, beta receptor II (70/80kDa);transforming growth factor, beta receptor II alpha;transforming growth factor, beta receptor II beta;transforming growth factor, beta receptor II delta;transforming growth factor, beta receptor II epsilon;transforming growth factor, beta receptor II gamma
Weitere Details:: The protein encoded by this gene is a transmembrane protein that has a protein kinase domain, forms a heterodimeric complex with TGF-beta receptor type-1, and binds TGF-beta. This receptor/ligand complex phosphorylates proteins, which then enter the nucleus and regulate the transcription of genes related to cell proliferation, cell cycle arrest, wound healing, immunosuppression, and tumorigenesis. Mutations in this gene have been associated with Marfan Syndrome, Loeys-Deitz Aortic Aneurysm Syndrome, and the development of various types of tumors. Alternatively spliced transcript variants encoding different isoforms have been characterized.

Versandbedingungen:: Blue Ice