NOP58 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A14129
Zusätzliche Namen:: HSPC120|NOP5|NOP5/NOP58|NOP58
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 68kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: RMLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRTLEDRGIRKISGTGKALAKTEKYEHKSEVKTYDPSGDSTLPTCSKKRKIEQVDKEDEITEKKAKKAKIKVKVEEEEEEKVAEEEETSVKKKKKRGKKKHIKEEPLSEEEPCTSTAIASPEKKKKKKKKRENED
Uniprot:: Q9Y2X3
Synonyme:: HSPC120;NOP5;NOP5/NOP58;NOP58 ribonucleoprotein homolog;nucleolar protein 5;nucleolar protein 58;nucleolar protein NOP5/NOP58
Weitere Details:: The protein encoded by this gene is a core component of box C/D small nucleolar ribonucleoproteins. Some box C/D small nucleolar RNAs (snoRNAs), such as U3, U8, and U14, are dependent upon the encoded protein for their synthesis. This protein is SUMOylated, which is necessary for high affinity binding to snoRNAs.