NOP16 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A14128
Zusätzliche Namen:: HSPC111|HSPC185|NOP16
Anwendung:: ELISA, WB
Molekulargewicht:: 21kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MPKAKGKTRRQKFGYSVNRKRLNRNARRKAAPRIECSHIRHAWDHAKSVRQNLAEMGLAVDPNRAVPLRKRKVKAMEVDIEERPKELVRKPYVLNDLEAEASLPEKKGNTLSRDLIDYVRYMVENHGEDYKAMARDEKNYYQDTPKQIRSKINVYKRFYPAEWQDFLDSLQKRKMEVE
Uniprot:: Q9Y3C1
Synonyme:: HBV pre-S2 trans-regulated protein 3;HSPC111;HSPC185;hypothetical protein HSPC111;NOP16 nucleolar protein homolog;nucleolar protein 16;nucleolar protein 16 homolog
Weitere Details:: This gene encodes a protein that is localized to the nucleolus. Expression of this gene is induced by estrogens and Myc protein and is a marker of poor patient survival in breast cancer. Alternative splicing results in multiple transcript variants.