HLA-DPB1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A1412
Zusätzliche Namen:: DPB1|HLA-DP|HLA-DP1B|HLA-DPB|HLA-DPB1
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 25-35 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: RATPENYLFQGRQECYAFNGTQRFLERYIYNREEFARFDSDVGEFRAVTELGRPAAEYWNSQKDILEEKRAVPDRMCRHNYELGGPMTLQRRVQPRVNVSPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDWTFQILVMLEMTPQQGDVYTCQVEHTSLDSPVTVEWKAQSDSARSK
Uniprot:: P04440
Synonyme:: DPB1;HLA class II histocompatibility antigen, DP beta 1 chain;HLA class II histocompatibility antigen, DP(W4) beta chain;HLA-DP;HLA-DP histocompatibility type, beta-1 subunit;HLA-DP1B;HLA-DPB;MHC class II antigen DPB1;MHC class II HLA-DP-beta-1;MHC HLA DPB1
Weitere Details:: HLA-DPB belongs to the HLA class II beta chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DPA) and a beta chain (DPB), both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The beta chain is approximately 26-28 kDa and its gene contains 6 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and exon 5 encodes the cytoplasmic tail. Within the DP molecule both the alpha chain and the beta chain contain the polymorphisms specifying the peptide binding specificities, resulting in up to 4 different molecules.

Versandbedingungen:: Blue Ice