A14092
FXR2 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A14092
- Zusätzliche Namen:
- FMR1L2|FXR2|FXR2P
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 110kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- RRRTDEDRTVMDGGLESDGPNMTENGLEDESRPQRRNRSRRRRNRGNRTDGSISGDRQPVTVADYISRAESQSRQRPPLERTKPSEDSLSGQKGDSVSKLP
- Uniprot:
- P51116
- Synonyme:
- FMR1L2;fragile X mental retardation syndrome-related protein 2;fragile X mental retardation, autosomal homolog 2;fragile X-mental retardation 1-like 2;FXR2P
- Weitere Details:
- The protein encoded by this gene is a RNA binding protein containing two KH domains and one RCG box, which is similar to FMRP and FXR1. It associates with polyribosomes, predominantly with 60S large ribosomal subunits. This encoded protein may self-associate or interact with FMRP and FXR1. It may have a role in the development of fragile X cognitive disability syndrome.
- Versandbedingungen:
- Blue Ice